Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CYTH2 Rabbit Polyclonal Antibody (Biotin)

CYTH2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

ARNO, CTS18, PSCD2, SEC7L, PSCD2L, CTS18.1, Sec7p-L, Sec7p-like, cytohesin-2

UniProt

Q99418

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human CYTH2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: GRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVDDPRKPN

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

46kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_059431

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IRAK1 Protein Vector (Rat) (pPB-C-His)
PV274938 500 ng

IRAK1 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
POU6F1 (1-301, His-tag) Human Protein
AR50950PU-N 500 µg

POU6F1 (1-301, His-tag) Human Protein

Sign In for Pricing
View Details
Human Polyhomeotic-like protein 2, PHC2 ELISA KIT
ELI-36335h 96 Tests

Human Polyhomeotic-like protein 2, PHC2 ELISA KIT

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli (strain K12/DH10B) NANE Polyclonal Antibody
MBS7170816 Inquire

Rabbit anti-Escherichia coli (strain K12/DH10B) NANE Polyclonal Antibody

Sign In for Pricing
View Details
Chicken Chemokine C C Motif Ligand 16 ELISA kit
GTR10382117 96 Well

Chicken Chemokine C C Motif Ligand 16 ELISA kit

Sign In for Pricing
View Details
S- (1,2-Dicarboxyethyl) glutathione
T81234-01 5 mg

S- (1,2-Dicarboxyethyl) glutathione

Sign In for Pricing
View Details