Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DCAF8 Rabbit Polyclonal Antibody (FITC)

DCAF8 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

GAN2, H326, WDR42A

UniProt

Q5TAQ9

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human DCAF8

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LPVLATSGLDHDVKIWAPTAEASTELTGLKDVIKKNKRERDEDSLHQTDL

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

67kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_056541

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CFD Recombinant Protein (Rat)
RP194702 100 µg

CFD Recombinant Protein (Rat)

Sign In for Pricing
View Details
Carteolol HCl
C10077 5 mg

Carteolol HCl

Sign In for Pricing
View Details
Sheep Tyrosine Kinase With Immunoglobulin Like and EGF Like Domains Protein 1 ELISA Kit
MBS050401-01 48 Well

Sheep Tyrosine Kinase With Immunoglobulin Like and EGF Like Domains Protein 1 ELISA Kit

Sign In for Pricing
View Details
Sheep Tyrosine Kinase With Immunoglobulin Like and EGF Like Domains Protein 1 ELISA Kit
MBS050401-02 96 Well

Sheep Tyrosine Kinase With Immunoglobulin Like and EGF Like Domains Protein 1 ELISA Kit

Sign In for Pricing
View Details
Sheep Tyrosine Kinase With Immunoglobulin Like and EGF Like Domains Protein 1 ELISA Kit
MBS050401-03 5x 96 Well

Sheep Tyrosine Kinase With Immunoglobulin Like and EGF Like Domains Protein 1 ELISA Kit

Sign In for Pricing
View Details
Sheep Tyrosine Kinase With Immunoglobulin Like and EGF Like Domains Protein 1 ELISA Kit
MBS050401-04 10x 96 Well

Sheep Tyrosine Kinase With Immunoglobulin Like and EGF Like Domains Protein 1 ELISA Kit

Sign In for Pricing
View Details