Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DCAF8L2 Rabbit Polyclonal Antibody (HRP)

DCAF8L2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

WDR42C

UniProt

J3KT06

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human DCAF8L2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VKIWTPTAKAATELTGLKKVIKKNKWERDEDSLHHGSLFDQYMLWFLLRH

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

71kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001130005

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACVR1B (Activin Receptor Type-1B, Activin Receptor Type IB, Serine/Threonine-protein Kinase Receptor R2, SKR2, Activin Receptor-like Kinase 4, ACVRLK4, ALK4) (AP) discontinued
122946-AP 100 µL

ACVR1B (Activin Receptor Type-1B, Activin Receptor Type IB, Serine/Threonine-protein Kinase Receptor R2, SKR2, Activin Receptor-like Kinase 4, ACVRLK4, ALK4) (AP) discontinued

Sign In for Pricing
View Details
SLC18A1 Antibody
E19-9379-2 100 µg -100 µL

SLC18A1 Antibody

Sign In for Pricing
View Details
Human cell line LOVO colon cancer cell line dual-labeled with luciferase and GFP
SL550095 1 Vial

Human cell line LOVO colon cancer cell line dual-labeled with luciferase and GFP

Sign In for Pricing
View Details
Anti-B7-H3/CD276 Antibody (Omburtamab)
F1174-50 50 mg

Anti-B7-H3/CD276 Antibody (Omburtamab)

Sign In for Pricing
View Details
WDR5A Antibody
orb798617 2 mg

WDR5A Antibody

Sign In for Pricing
View Details
Recombinant Campylobacter Jejuni thiG Protein (aa 1-258) (strain 81116 / NCTC 11828)
VAng-Ly2454-1mgEcoli 1 mg (E. coli)

Recombinant Campylobacter Jejuni thiG Protein (aa 1-258) (strain 81116 / NCTC 11828)

Sign In for Pricing
View Details