Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DCAF17 Rabbit Polyclonal Antibody (Biotin)

DCAF17 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

C2orf37, C20orf37

UniProt

F5H7W1

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human DCAF17

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: FDNYRRCVSSVASEPRKLYEMPKCSKSEKIEDALLWECPVGDILPNSSDY

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

51kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001158293

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Multiplex Assay Kit for Troponin T Type 2, Cardiac (TNNT2), etc. by FLIA (Flow Luminescence Immunoassay)
TRV-0029852 96 Tests

Multiplex Assay Kit for Troponin T Type 2, Cardiac (TNNT2), etc. by FLIA (Flow Luminescence Immunoassay)

Sign In for Pricing
View Details
Guanine nucleotide-binding protein G (GNAI1) Human ELISA Kit
D8970 96 Tests

Guanine nucleotide-binding protein G (GNAI1) Human ELISA Kit

Sign In for Pricing
View Details
FGFR2 Knockout 786O Polyclonal Cells
ARG5694 1 Million

FGFR2 Knockout 786O Polyclonal Cells

Sign In for Pricing
View Details
Histone H1t (HIST1H1T) Rat ELISA Kit
E0557 96 Tests

Histone H1t (HIST1H1T) Rat ELISA Kit

Sign In for Pricing
View Details
Gelsolin Rabbit Polyclonal Antibody (BF405)
orb2542670 100 µL

Gelsolin Rabbit Polyclonal Antibody (BF405)

Sign In for Pricing
View Details
CD31/PECAM1 Protein (Human)
P514014 100 µg

CD31/PECAM1 Protein (Human)

Sign In for Pricing
View Details