Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DENND2A Rabbit Polyclonal Antibody (Biotin)

DENND2A Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

FAM31D, KIAA1277

UniProt

Q9ULE3

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human DENND2A

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: DRSLENVYRGSEGSPTKPFINPLPKPRRTFKHAGEGDKDGKPGIGFRKEK

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

113kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_056504

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

KBTBD8 antibody
70R-10021 100 µL

KBTBD8 antibody

Sign In for Pricing
View Details
Rabbit Polyclonal Anti-PMS2 Antibody
TA351545 100 µL

Rabbit Polyclonal Anti-PMS2 Antibody

Sign In for Pricing
View Details
Carcino Embryonic Antigen (CEA) /CD66 ELISA kit
E22-TMC002.48 48 Tests

Carcino Embryonic Antigen (CEA) /CD66 ELISA kit

Sign In for Pricing
View Details
Myelin-associated glycoprotein MAG Rabbit Polyclonal Antibody (Fluoro550)
orb3081933 100 µg

Myelin-associated glycoprotein MAG Rabbit Polyclonal Antibody (Fluoro550)

Sign In for Pricing
View Details
RGS7 (Regulator of G Protein Signaling 7)
490483 100 µL

RGS7 (Regulator of G Protein Signaling 7)

Sign In for Pricing
View Details
MAP Kinase 10, NT (Mitogen-activated Protein Kinase 10, MAPK 10, MAPK10, PRKM10, c-Jun N-terminal Kinase 3, JNK3, JNK3A, MAP Kinase p49 3F12, p493F12, p54bSAPK, Stress-activated Protein Kinase 1b, SAPK1b, Stress-activated Protein Kinase JNK3) (PE) discontinued
M2362-38B-PE 200 µL

MAP Kinase 10, NT (Mitogen-activated Protein Kinase 10, MAPK 10, MAPK10, PRKM10, c-Jun N-terminal Kinase 3, JNK3, JNK3A, MAP Kinase p49 3F12, p493F12, p54bSAPK, Stress-activated Protein Kinase 1b, SAPK1b, Stress-activated Protein Kinase JNK3) (PE) discontinued

Sign In for Pricing
View Details