Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DENND2A Rabbit Polyclonal Antibody (HRP)

DENND2A Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FAM31D, KIAA1277

UniProt

Q9ULE3

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human DENND2A

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DRSLENVYRGSEGSPTKPFINPLPKPRRTFKHAGEGDKDGKPGIGFRKEK

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

113kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_056504

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human alpha smooth muscle Actin (ACTA2) activation kit by CRISPRa
GA100046 1 Kit

Human alpha smooth muscle Actin (ACTA2) activation kit by CRISPRa

Sign In for Pricing
View Details
Varisacumab Biosimilar - Research Grade
ICH5969-1mg 1 mg

Varisacumab Biosimilar - Research Grade

Sign In for Pricing
View Details
Tissue Array, Human, BioAssayTM Endometrial carcinoma (Adenocarcinoma grade I ~ III, few adenosquamous) with normal tissue controls discontinued
T5596-0471 1Array

Tissue Array, Human, BioAssayTM Endometrial carcinoma (Adenocarcinoma grade I ~ III, few adenosquamous) with normal tissue controls discontinued

Sign In for Pricing
View Details
BCL2L1 Antibody (Phospho-Thr115) (OABF01541-100UL)
OABF01541-100UL 100 µL

BCL2L1 Antibody (Phospho-Thr115) (OABF01541-100UL)

Sign In for Pricing
View Details
METTL6 CRISPR Knock Out 293T Cell Line (Human)
28419141 1x 10^6 Cells / 1.0 mL

METTL6 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
Tbc1d10c (NM_178650) Mouse Tagged ORF Clone Lentiviral Particle
MR223233L4V 200 µL

Tbc1d10c (NM_178650) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details