Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DHRS7C Rabbit Polyclonal Antibody (FITC)

DHRS7C Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

SDR32C2

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human DHRS7C

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: HVYPEQGNWEASIWKFFFRKLTYGVHPVEVAEEVMRTVRRKKQEVFMANP

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001099041

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLBD1 Protein Vector (Mouse) (pPB-C-His)
PV216830 500 ng

PLBD1 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Rat C-telopeptide of type I collagen (CTX-I) ELISA Kit
OM641662 96 Tests

Rat C-telopeptide of type I collagen (CTX-I) ELISA Kit

Sign In for Pricing
View Details
Mouse Ddx54 Pre-designed siRNA Set A
SI103520A 1 Each

Mouse Ddx54 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Caveolin 2 (Phospho-Ser36) Antibody
12469-01 50 µL

Caveolin 2 (Phospho-Ser36) Antibody

Sign In for Pricing
View Details
Caveolin 2 (Phospho-Ser36) Antibody
12469-02 100 µL

Caveolin 2 (Phospho-Ser36) Antibody

Sign In for Pricing
View Details
Protein A Antibody
5500-100 100 µg

Protein A Antibody

Sign In for Pricing
View Details