Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DHRS12 Rabbit Polyclonal Antibody (FITC)

DHRS12 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

SDR40C1

UniProt

A0PJE2

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human DHRS12

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: FKQEHKLHVLINNAGCMVNKRELTEDGLEKNFAANTLGVYILTTGLIPVL

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

30kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Human, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_078981

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SF3A1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4D8]
TA800588BM 100 µL

SF3A1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4D8]

Sign In for Pricing
View Details
Usp9x sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
49345114 3x 1.0 µg

Usp9x sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Blk discontinued
B2107A 100 µL

Blk discontinued

Sign In for Pricing
View Details
Kappa Opioid receptor Rabbit Polyclonal Antibody (APC-Cy5.5)
orb2548979 100 µL

Kappa Opioid receptor Rabbit Polyclonal Antibody (APC-Cy5.5)

Sign In for Pricing
View Details
KATNAL1 (Katanin p60 ATPase-containing Subunit A-like 1, Katanin p60 Subunit A-like 1, p60 Katanin-like 1) (AP)
MBS6269726-01 0.1 mL

KATNAL1 (Katanin p60 ATPase-containing Subunit A-like 1, Katanin p60 Subunit A-like 1, p60 Katanin-like 1) (AP)

Sign In for Pricing
View Details
KATNAL1 (Katanin p60 ATPase-containing Subunit A-like 1, Katanin p60 Subunit A-like 1, p60 Katanin-like 1) (AP)
MBS6269726-02 5x 0.1 mL

KATNAL1 (Katanin p60 ATPase-containing Subunit A-like 1, Katanin p60 Subunit A-like 1, p60 Katanin-like 1) (AP)

Sign In for Pricing
View Details