Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DHRS12 Rabbit Polyclonal Antibody (HRP)

DHRS12 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SDR40C1

UniProt

A0PJE2

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human DHRS12

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FKQEHKLHVLINNAGCMVNKRELTEDGLEKNFAANTLGVYILTTGLIPVL

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

30kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Human, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_078981

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF749 Polyclonal Antibody, PE-Cy7 Conjugated
bs-12229R-PE-Cy7 100 µL

ZNF749 Polyclonal Antibody, PE-Cy7 Conjugated

Sign In for Pricing
View Details
Porcine BRI3 binding protein (BRI3BP) ELISA kit
GTR10462885 96 Well

Porcine BRI3 binding protein (BRI3BP) ELISA kit

Sign In for Pricing
View Details
Recombinant Human A disintegrin and metalloproteinase with thrombospondin motifs 18(ADAMTS18), partial
AP77874-01 20 µg

Recombinant Human A disintegrin and metalloproteinase with thrombospondin motifs 18(ADAMTS18), partial

Sign In for Pricing
View Details
Recombinant Human A disintegrin and metalloproteinase with thrombospondin motifs 18(ADAMTS18), partial
AP77874-02 100 µg

Recombinant Human A disintegrin and metalloproteinase with thrombospondin motifs 18(ADAMTS18), partial

Sign In for Pricing
View Details
Recombinant Human A disintegrin and metalloproteinase with thrombospondin motifs 18(ADAMTS18), partial
AP77874-03 1 mg

Recombinant Human A disintegrin and metalloproteinase with thrombospondin motifs 18(ADAMTS18), partial

Sign In for Pricing
View Details
AKR7A2 (aldo-keto Reductase Family 7, Member A2 (aflatoxin aldehyde Reductase), AFAR, AFAR1, AFB1-AR1, AKR7) (MaxLight 405)
MBS6194437-01 0.1 mL

AKR7A2 (aldo-keto Reductase Family 7, Member A2 (aflatoxin aldehyde Reductase), AFAR, AFAR1, AFB1-AR1, AKR7) (MaxLight 405)

Sign In for Pricing
View Details