Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DNAJC18 Rabbit Polyclonal Antibody (Biotin)

DNAJC18 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

Q9H819

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human DNAJC18

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: EWTQTRQGEGNSTYSEEQLLGVQRIKKCRNYYEILGVSRDASDEELKKAY

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_689899

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DEFA10P Protein Vector (Human) (pPM-C-HA)
PV072607 500 ng

DEFA10P Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
PHF11 (PHD Finger Protein 11, APY, BCAP, IGEL, IGER, IGHER, NYREN34, NY-REN-34) (MaxLight 490)
MBS6431452-01 0.1 mL

PHF11 (PHD Finger Protein 11, APY, BCAP, IGEL, IGER, IGHER, NYREN34, NY-REN-34) (MaxLight 490)

Sign In for Pricing
View Details
PHF11 (PHD Finger Protein 11, APY, BCAP, IGEL, IGER, IGHER, NYREN34, NY-REN-34) (MaxLight 490)
MBS6431452-02 5x 0.1 mL

PHF11 (PHD Finger Protein 11, APY, BCAP, IGEL, IGER, IGHER, NYREN34, NY-REN-34) (MaxLight 490)

Sign In for Pricing
View Details
cgi-EGFP-HERG(F557L) Plasmid
PVTB01024-2b 2 µg

cgi-EGFP-HERG(F557L) Plasmid

Sign In for Pricing
View Details
NAIF1 CRISPR Activation Plasmid (m2)
sc-427910-ACT-2 20 µg

NAIF1 CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details
PDGFR Antibody
AM1952b 400 µL

PDGFR Antibody

Sign In for Pricing
View Details