Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DUS3L Rabbit Polyclonal Antibody (FITC)

DUS3L Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

DUS3

UniProt

Q96G46

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human DUS3L

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: GQTEEAAEPGEQLQTQKRARGQNKGRPHVKPTNYDKNRLCPSLIQESAAK

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

53kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Guinea pig Cysteine-rich PAK1 inhibitor (CRIPAK) ELISA Kit
MBS7200475-01 48 Well

Guinea pig Cysteine-rich PAK1 inhibitor (CRIPAK) ELISA Kit

Sign In for Pricing
View Details
Guinea pig Cysteine-rich PAK1 inhibitor (CRIPAK) ELISA Kit
MBS7200475-02 96 Well

Guinea pig Cysteine-rich PAK1 inhibitor (CRIPAK) ELISA Kit

Sign In for Pricing
View Details
Guinea pig Cysteine-rich PAK1 inhibitor (CRIPAK) ELISA Kit
MBS7200475-03 5x 96 Well

Guinea pig Cysteine-rich PAK1 inhibitor (CRIPAK) ELISA Kit

Sign In for Pricing
View Details
Guinea pig Cysteine-rich PAK1 inhibitor (CRIPAK) ELISA Kit
MBS7200475-04 10x 96 Well

Guinea pig Cysteine-rich PAK1 inhibitor (CRIPAK) ELISA Kit

Sign In for Pricing
View Details
CFLAR Over-expression Lysate Product
GWB-A09610 0.1 mg

CFLAR Over-expression Lysate Product

Sign In for Pricing
View Details
8 Strip PCR Tubes Red-600 Str - PK600
PCR1004 600 / PCK

8 Strip PCR Tubes Red-600 Str - PK600

Sign In for Pricing
View Details