Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DUS3L Rabbit Polyclonal Antibody (FITC)

DUS3L Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

DUS3

UniProt

Q96G46

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human DUS3L

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: GQTEEAAEPGEQLQTQKRARGQNKGRPHVKPTNYDKNRLCPSLIQESAAK

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

53kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human IL13 protein, N-His Tag
IMP-2488 10 µg

Recombinant Human IL13 protein, N-His Tag

Sign In for Pricing
View Details
Phospho-mouse TSC1 (S594) Antibody
orb1930917-01 50 µL

Phospho-mouse TSC1 (S594) Antibody

Sign In for Pricing
View Details
Phospho-mouse TSC1 (S594) Antibody
orb1930917-02 100 µL

Phospho-mouse TSC1 (S594) Antibody

Sign In for Pricing
View Details
UBE2O CRISPR Activation Plasmid (m)
sc-432207-ACT 20 µg

UBE2O CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details
Rabbit anti-human alkB, alkylation repair homolog 1 (E. coli) polyclonal Antibody
MBS712137-01 0.1 mL

Rabbit anti-human alkB, alkylation repair homolog 1 (E. coli) polyclonal Antibody

Sign In for Pricing
View Details
Rabbit anti-human alkB, alkylation repair homolog 1 (E. coli) polyclonal Antibody
MBS712137-02 5x 0.1 mL

Rabbit anti-human alkB, alkylation repair homolog 1 (E. coli) polyclonal Antibody

Sign In for Pricing
View Details