Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EFCAB1 Rabbit Polyclonal Antibody (HRP)

EFCAB1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q9HAE3

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human EFCAB1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EKMKYCFEVFDLNGDGFISKEEMFHMLKNSLLKQPSEEDPDEGIKDLVEI

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

23kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_078869

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TFAP2E Protein Vector (Rat) (pPM-C-His)
PV310489 500 ng

TFAP2E Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
FAM70A Rabbit Polyclonal Antibody (BF750)
orb2548565 100 µL

FAM70A Rabbit Polyclonal Antibody (BF750)

Sign In for Pricing
View Details
Anti-Human PMF1 Antibody (Biotine Conjugate)
DZ41628-Biotin 200 µL/Vial

Anti-Human PMF1 Antibody (Biotine Conjugate)

Sign In for Pricing
View Details
RXRB, ID (RXRB, NR2B2, Retinoic acid receptor RXR-beta, Nuclear receptor subfamily 2 group B member 2, Retinoid X receptor beta) (Biotin)
MBS6344559-01 0.2 mL

RXRB, ID (RXRB, NR2B2, Retinoic acid receptor RXR-beta, Nuclear receptor subfamily 2 group B member 2, Retinoid X receptor beta) (Biotin)

Sign In for Pricing
View Details
RXRB, ID (RXRB, NR2B2, Retinoic acid receptor RXR-beta, Nuclear receptor subfamily 2 group B member 2, Retinoid X receptor beta) (Biotin)
MBS6344559-02 5x 0.2 mL

RXRB, ID (RXRB, NR2B2, Retinoic acid receptor RXR-beta, Nuclear receptor subfamily 2 group B member 2, Retinoid X receptor beta) (Biotin)

Sign In for Pricing
View Details
TAF5 Antibody
MBS9505247-01 0.05 mL

TAF5 Antibody

Sign In for Pricing
View Details