Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EFTUD2 Rabbit Polyclonal Antibody (HRP)

EFTUD2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MFDM, MFDGA, Snu114, Snrp116, SNRNP116, U5-116KD

UniProt

Q15029

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human EFTUD2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ADTFGDINYQEFAKRLWGDIYFNPKTRKFTKKAPTSSSQRSFVEFILEPL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

109kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_004238

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat Forkhead Box Protein M1 (FOXM1) ELISA Kit
MBS9369085 Inquire

Goat Forkhead Box Protein M1 (FOXM1) ELISA Kit

Sign In for Pricing
View Details
MANF, NT (MANF, ARMET, ARP, Mesencephalic astrocyte-derived neurotrophic factor, Arginine-rich protein, Protein ARMET) (MaxLight 650) discontinued
038087-ML650 100 µL

MANF, NT (MANF, ARMET, ARP, Mesencephalic astrocyte-derived neurotrophic factor, Arginine-rich protein, Protein ARMET) (MaxLight 650) discontinued

Sign In for Pricing
View Details
NikR Antibody (Biotin)
orb351972-01 50 µg

NikR Antibody (Biotin)

Sign In for Pricing
View Details
NikR Antibody (Biotin)
orb351972-02 100 µg

NikR Antibody (Biotin)

Sign In for Pricing
View Details
M/M036/NT-PP-PHOLUMB-DIA200/1-B Safety & Regulatory Compliance Signs (No Adhesive)
135475 1 Pack (1 Panel (s) x 1 Pack)

M/M036/NT-PP-PHOLUMB-DIA200/1-B Safety & Regulatory Compliance Signs (No Adhesive)

Sign In for Pricing
View Details
Anterior Gradient 2/AGR2 Rabbit Polyclonal Antibody (HRP)
orb2616517 100 µg

Anterior Gradient 2/AGR2 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details