Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EIF5A Rabbit Polyclonal Antibody (Biotin)

EIF5A Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

EIF-5A, EIF5A1, eIF-4D, eIF5AI

UniProt

P63241

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human EIF5A

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYEDICPSTHNMDVP

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

20kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Dickkopf 2 (DKK2) ELISA Kit
YP-W30082-01 48 Tests

Rat Dickkopf 2 (DKK2) ELISA Kit

Sign In for Pricing
View Details
Rat Dickkopf 2 (DKK2) ELISA Kit
YP-W30082-02 96 Tests

Rat Dickkopf 2 (DKK2) ELISA Kit

Sign In for Pricing
View Details
Lentiviral mouse Aurkaip1 shRNA (UAS) - Lentiviral mouse Aurkaip1 shRNA (UAS, iRFP) (25)
GTR15256790 1 Vial

Lentiviral mouse Aurkaip1 shRNA (UAS) - Lentiviral mouse Aurkaip1 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
EHD1 Rabbit mAb
C06060-100uL 100 µL

EHD1 Rabbit mAb

Sign In for Pricing
View Details
Anti-GTF2E1 Antibody
A11288 100 µL

Anti-GTF2E1 Antibody

Sign In for Pricing
View Details
PRDX2 Rabbit Polyclonal Antibody
orb580358 100 µL

PRDX2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details