Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ENO4 Rabbit Polyclonal Antibody (Biotin)

ENO4 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

C10orf134

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human ENO4

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: FFASKVQEDKGRKELEKSLEYSTVPTPLPPVPPPPPPPPPTKKKGQKPGR

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

68kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_001229628

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3- (2-Methoxyphenyl) -3-oxo-propionic acid methyl ester ≥97% (HPLC)
231219-01 250 mg

3- (2-Methoxyphenyl) -3-oxo-propionic acid methyl ester ≥97% (HPLC)

Sign In for Pricing
View Details
3- (2-Methoxyphenyl) -3-oxo-propionic acid methyl ester ≥97% (HPLC)
231219-02 1 g

3- (2-Methoxyphenyl) -3-oxo-propionic acid methyl ester ≥97% (HPLC)

Sign In for Pricing
View Details
Recombinant Human ADAMTS8 Protein, N-His
YHJ82701 100 μg

Recombinant Human ADAMTS8 Protein, N-His

Sign In for Pricing
View Details
Recombinant Clostridium botulinum Putative competence-damage inducible protein (cinA)
MBS1105359-01 0.02 mg (E-Coli)

Recombinant Clostridium botulinum Putative competence-damage inducible protein (cinA)

Sign In for Pricing
View Details
Recombinant Clostridium botulinum Putative competence-damage inducible protein (cinA)
MBS1105359-02 0.02 mg (Yeast)

Recombinant Clostridium botulinum Putative competence-damage inducible protein (cinA)

Sign In for Pricing
View Details
Recombinant Clostridium botulinum Putative competence-damage inducible protein (cinA)
MBS1105359-03 0.1 mg (E-Coli)

Recombinant Clostridium botulinum Putative competence-damage inducible protein (cinA)

Sign In for Pricing
View Details