ENPP7 Rabbit Polyclonal Antibody (HRP)
ENPP7 Rabbit Polyclonal Antibody (HRP)
Product Specifications
Product Name Alternative
NPP7, NPP-7, E-NPP 7, ALK-SMase
UniProt
Q6UWV6
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human ENPP7
Clonality
Polyclonal
Conjugation
HRP
Sequence
Synthetic peptide located within the following region: DLDLVTLYFGEPDSTGHRYGPESPERREMVRQVDRTVGYLRESIARNHLT
Field of Research
Signal Transduction
Purification
Affinity Purified
Form
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Molecular Weight
49kDa
Storage Conditions
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Notes
For research use only.
Prediction Reactivity
Bovine, Equine, Human, Porcine, Rabbit, Rat, Zebrafish
Tested Applications
WB
NCBI Accession Number
NP_848638
Host or Source
Rabbit
Preservative
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6304860-01 0.1 mL
GTF2F1, ID (GTF2F1, RAP74, General transcription factor IIF subunit 1, General transcription factor IIF 74kD subunit, Transcription initiation factor IIF subunit alpha, Transcription initiation factor RAP74) (MaxLight 405)
Sign In for Pricing
View Details MBS6304860-02 5x 0.1 mL
GTF2F1, ID (GTF2F1, RAP74, General transcription factor IIF subunit 1, General transcription factor IIF 74kD subunit, Transcription initiation factor IIF subunit alpha, Transcription initiation factor RAP74) (MaxLight 405)
Sign In for Pricing
View Details MBS910903-01 24 Well (LIMIT 1)
Human Carboxypeptidase N subunit 2, CPN2 ELISA Kit
Sign In for Pricing
View Details MBS910903-02 48 Well
Human Carboxypeptidase N subunit 2, CPN2 ELISA Kit
Sign In for Pricing
View Details MBS910903-03 96 Well
Human Carboxypeptidase N subunit 2, CPN2 ELISA Kit
Sign In for Pricing
View Details MBS910903-04 5x 96 Well
Human Carboxypeptidase N subunit 2, CPN2 ELISA Kit
Sign In for Pricing
View Details