Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ENPP7 Rabbit Polyclonal Antibody (HRP)

ENPP7 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

NPP7, NPP-7, E-NPP 7, ALK-SMase

UniProt

Q6UWV6

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human ENPP7

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: WITAQRQGLRAGSFFYPGGNVTYQGVAVTRSRKEGIAHNYKNETEWRANI

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

49kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_848638

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human CENPH sgRNA gene knockout kit - Lentiviral human CENPH sgRNA gene knockout kit (25)
GTR15360447 1 Vial

Lentiviral human CENPH sgRNA gene knockout kit - Lentiviral human CENPH sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
SRC Antibody
orb676185-01 50 µg

SRC Antibody

Sign In for Pricing
View Details
SRC Antibody
orb676185-02 100 µg

SRC Antibody

Sign In for Pricing
View Details
PI3 Kinase p110 delta antibody, AbBy Fluor™ 405 Conjugated
bs-10656R-BF405-01 20 µL

PI3 Kinase p110 delta antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
PI3 Kinase p110 delta antibody, AbBy Fluor™ 405 Conjugated
bs-10656R-BF405-02 100 µL

PI3 Kinase p110 delta antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
Xpress™ Human AMZ1 Over-expressing Stable Cell Line
ABC-X0136 1 Vial

Xpress™ Human AMZ1 Over-expressing Stable Cell Line

Sign In for Pricing
View Details