Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ESPNL Rabbit Polyclonal Antibody (HRP)

ESPNL Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q6ZVH7

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human ESPNL

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EPGRKSGLTLLGPLPHAAVPCSGPEPTAQRLGSRSQQGSFNGEDICGYIN

Field of Research

Musculoskeletal & Connective Tissue Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

105kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_919288

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HIST1H2AB, NT (HIST1H2AB, H2AFM, Histone H2A type 1-B/E, Histone H2A.2, Histone H2A/a, Histone H2A/m) (MaxLight 750)
MBS6306734-01 0.1 mL

HIST1H2AB, NT (HIST1H2AB, H2AFM, Histone H2A type 1-B/E, Histone H2A.2, Histone H2A/a, Histone H2A/m) (MaxLight 750)

Sign In for Pricing
View Details
HIST1H2AB, NT (HIST1H2AB, H2AFM, Histone H2A type 1-B/E, Histone H2A.2, Histone H2A/a, Histone H2A/m) (MaxLight 750)
MBS6306734-02 5x 0.1 mL

HIST1H2AB, NT (HIST1H2AB, H2AFM, Histone H2A type 1-B/E, Histone H2A.2, Histone H2A/a, Histone H2A/m) (MaxLight 750)

Sign In for Pricing
View Details
Lentiviral mouse Foxd2 shRNA (UAS) - Lentiviral mouseFoxd2 shRNA (UAS, GFP) (25)
GTR15105188 1 Vial

Lentiviral mouse Foxd2 shRNA (UAS) - Lentiviral mouseFoxd2 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
Rabbit Anti Human USP13 Monoclonal Clone ADDG-21 100ug
IRBAHUUSP13ADDG21C100ug 100 µg

Rabbit Anti Human USP13 Monoclonal Clone ADDG-21 100ug

Sign In for Pricing
View Details
LNX1 Recombinant Protein (Mouse)
RP147776 100 µg

LNX1 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
Recombinant Human E2F2 protein (His tag)
PDEH101062-01 20 µg

Recombinant Human E2F2 protein (His tag)

Sign In for Pricing
View Details