Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FADS6 Rabbit Polyclonal Antibody (FITC)

FADS6 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

FP18279

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human FADS6

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: GFKNPSSALGCMFLTRSLLAHPYLHVNIFQHIGLPMFSRDNKPRRIHMMS

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_835229

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

hIgG Kappa light chain Specific Rabbit monoclonal antibody, OTIR1G7
TA592621 100 µL

hIgG Kappa light chain Specific Rabbit monoclonal antibody, OTIR1G7

Sign In for Pricing
View Details
AF/LE Purified Anti-Mouse Ly6C Antibody[Monts 1]
E-AB-F11210-01 100 µg

AF/LE Purified Anti-Mouse Ly6C Antibody[Monts 1]

Sign In for Pricing
View Details
AF/LE Purified Anti-Mouse Ly6C Antibody[Monts 1]
E-AB-F11210-02 1 mg

AF/LE Purified Anti-Mouse Ly6C Antibody[Monts 1]

Sign In for Pricing
View Details
AF/LE Purified Anti-Mouse Ly6C Antibody[Monts 1]
E-AB-F11210-03 5 mg

AF/LE Purified Anti-Mouse Ly6C Antibody[Monts 1]

Sign In for Pricing
View Details
AF/LE Purified Anti-Mouse Ly6C Antibody[Monts 1]
E-AB-F11210-04 25 mg

AF/LE Purified Anti-Mouse Ly6C Antibody[Monts 1]

Sign In for Pricing
View Details
AF/LE Purified Anti-Mouse Ly6C Antibody[Monts 1]
E-AB-F11210-05 50 mg

AF/LE Purified Anti-Mouse Ly6C Antibody[Monts 1]

Sign In for Pricing
View Details