Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FADS6 Rabbit Polyclonal Antibody (HRP)

FADS6 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FP18279

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human FADS6

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GFKNPSSALGCMFLTRSLLAHPYLHVNIFQHIGLPMFSRDNKPRRIHMMS

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_835229

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Hormone-sensitive lipase ELISA Kit
orb1660214 96 Tests

Mouse Hormone-sensitive lipase ELISA Kit

Sign In for Pricing
View Details
Tth DNA Ligase Swift (5U/ul) Thermostable
32581-01 100 Units (Weiss)

Tth DNA Ligase Swift (5U/ul) Thermostable

Sign In for Pricing
View Details
Tth DNA Ligase Swift (5U/ul) Thermostable
32581-02 200 Units (Weiss)

Tth DNA Ligase Swift (5U/ul) Thermostable

Sign In for Pricing
View Details
TRPC4AP (Short Transient Receptor Potential Channel 4-associated Protein, Trp4-associated Protein, Trpc4-associated Protein, TRRP4AP, Protein TAP1, TNF-receptor Ubiquitous Scaffolding/signaling Protein, Protein TRUSS, C20orf188) (MaxLight 405)
MBS6397352-01 0.1 mL

TRPC4AP (Short Transient Receptor Potential Channel 4-associated Protein, Trp4-associated Protein, Trpc4-associated Protein, TRRP4AP, Protein TAP1, TNF-receptor Ubiquitous Scaffolding/signaling Protein, Protein TRUSS, C20orf188) (MaxLight 405)

Sign In for Pricing
View Details
TRPC4AP (Short Transient Receptor Potential Channel 4-associated Protein, Trp4-associated Protein, Trpc4-associated Protein, TRRP4AP, Protein TAP1, TNF-receptor Ubiquitous Scaffolding/signaling Protein, Protein TRUSS, C20orf188) (MaxLight 405)
MBS6397352-02 5x 0.1 mL

TRPC4AP (Short Transient Receptor Potential Channel 4-associated Protein, Trp4-associated Protein, Trpc4-associated Protein, TRRP4AP, Protein TAP1, TNF-receptor Ubiquitous Scaffolding/signaling Protein, Protein TRUSS, C20orf188) (MaxLight 405)

Sign In for Pricing
View Details
Rabbit Polyclonal EMSY Antibody
NBP3-03289-20ul 20 µL

Rabbit Polyclonal EMSY Antibody

Sign In for Pricing
View Details