Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FADS6 Rabbit Polyclonal Antibody (HRP)

FADS6 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FP18279

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human FADS6

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GFKNPSSALGCMFLTRSLLAHPYLHVNIFQHIGLPMFSRDNKPRRIHMMS

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_835229

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TBKBP1 Rabbit Polyclonal Antibody
TA331972 100 µL

TBKBP1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Dermcidin (DCD) (NM_053283) Human Recombinant Protein
TP701063 50 µg

Dermcidin (DCD) (NM_053283) Human Recombinant Protein

Sign In for Pricing
View Details
EDEM3 Antibody - C-terminal region
ARP62508_P050-25UL 25 µL

EDEM3 Antibody - C-terminal region

Sign In for Pricing
View Details
Recombinant Clostridium Pasteurianum nifH6 Protein (aa 1-272)
VAng-Lsx00232-500gEcoli 500 µg (E. coli)

Recombinant Clostridium Pasteurianum nifH6 Protein (aa 1-272)

Sign In for Pricing
View Details
Recombinant Mouse Cereblon (CRBN)
RPU57597-01 50 µg

Recombinant Mouse Cereblon (CRBN)

Sign In for Pricing
View Details
Recombinant Mouse Cereblon (CRBN)
RPU57597-02 100 µg

Recombinant Mouse Cereblon (CRBN)

Sign In for Pricing
View Details