Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RIPOR1 Rabbit Polyclonal Antibody (HRP)

RIPOR1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FAM65A

UniProt

Q6ZS17

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human FAM65A

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SCETKDLFAALPQVVAVDINDLGTIKLSLEVTWSPFDKDDQPSAASSVNK

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

131kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_078795

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Goat Immunoglobulin Antibody
14401-500 500 µg

Anti-Goat Immunoglobulin Antibody

Sign In for Pricing
View Details
NUDT13 (Nucleoside Diphosphate-linked Moiety X Motif 13, Nudix Motif 13, Protein KiSS-16) (HRP)
130626-HRP 100 µL

NUDT13 (Nucleoside Diphosphate-linked Moiety X Motif 13, Nudix Motif 13, Protein KiSS-16) (HRP)

Sign In for Pricing
View Details
Major Basic Protein (PRG2) Human shRNA Plasmid Kit (Locus ID 5553)
TL310185 1 Kit

Major Basic Protein (PRG2) Human shRNA Plasmid Kit (Locus ID 5553)

Sign In for Pricing
View Details
Annexin V antibody
PAab09988 100 µg

Annexin V antibody

Sign In for Pricing
View Details
STK32A (Serine/Threonine-protein Kinase 32A, MGC22688, YANK1) (MaxLight 550)
MBS6214249-01 0.1 mL

STK32A (Serine/Threonine-protein Kinase 32A, MGC22688, YANK1) (MaxLight 550)

Sign In for Pricing
View Details
STK32A (Serine/Threonine-protein Kinase 32A, MGC22688, YANK1) (MaxLight 550)
MBS6214249-02 5x 0.1 mL

STK32A (Serine/Threonine-protein Kinase 32A, MGC22688, YANK1) (MaxLight 550)

Sign In for Pricing
View Details