Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FAM83A Rabbit Polyclonal Antibody (HRP)

FAM83A Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

BJ-TSA-9

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human FAM83A

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ANGRLSSSSGSASDRTSSNPFSGRSAGSHPVPESKQNKTKTKKQTTLWFL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_996889

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal SH2D1A Antibody (13) [Alexa Fluor 700]
NBP3-26885AF700 0.1 mL

Mouse Monoclonal SH2D1A Antibody (13) [Alexa Fluor 700]

Sign In for Pricing
View Details
Septin 8 Rabbit Polyclonal Antibody (FITC)
orb101987 100 µL

Septin 8 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
ALAS1 (aminolevulinate, delta-, Synthase 1, ALAS, ALAS3, ALASH, MIG4) (Biotin)
243238-Biotin 100 µL

ALAS1 (aminolevulinate, delta-, Synthase 1, ALAS, ALAS3, ALASH, MIG4) (Biotin)

Sign In for Pricing
View Details
EHBP1 Polyclonal Antibody, FITC Conjugated
A66512-100 100 µL

EHBP1 Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
Monkey Coiled-coil-helix-coiled-coil-helix domain-containing protein 8 (CHCHD8) ELISA Kit
MBS7252204-01 48 Well

Monkey Coiled-coil-helix-coiled-coil-helix domain-containing protein 8 (CHCHD8) ELISA Kit

Sign In for Pricing
View Details
Monkey Coiled-coil-helix-coiled-coil-helix domain-containing protein 8 (CHCHD8) ELISA Kit
MBS7252204-02 96 Well

Monkey Coiled-coil-helix-coiled-coil-helix domain-containing protein 8 (CHCHD8) ELISA Kit

Sign In for Pricing
View Details