Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FAM83D Rabbit Polyclonal Antibody (Biotin)

FAM83D Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

CHICA, C20orf129, dJ616B8.3

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human FAM83D

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: HFQSSNKFDHLTNRKPQSKELTLGNLLRMRLARLSSTPRKADLDPEMPAE

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

67kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_112181

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Myelin oligodendrocyte glycoprotein (MOG) Rabbit Polyclonal Antibody
TA367721 100 µL

Myelin oligodendrocyte glycoprotein (MOG) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Ap3b2 activation kit by CRISPRa
GA200214 1 Kit

Mouse Ap3b2 activation kit by CRISPRa

Sign In for Pricing
View Details
STAT1 Rabbit Polyclonal Antibody
AP02695PU-S 50 µL

STAT1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
AFP (Alpha Fetoprotein) (C2 + C3 + MBS-12), CF488A conjugate, 0.1mg/mL
BNC880810-100 1x 100 µL

AFP (Alpha Fetoprotein) (C2 + C3 + MBS-12), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TNFRSF14 Mouse Monoclonal Antibody [Clone ID: OTI7F1]
TA813628 100 µL

TNFRSF14 Mouse Monoclonal Antibody [Clone ID: OTI7F1]

Sign In for Pricing
View Details
Tissue Genomic DNA, Kidney
CD563972 5 µg

Tissue Genomic DNA, Kidney

Sign In for Pricing
View Details