Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FAM83D Rabbit Polyclonal Antibody (Biotin)

FAM83D Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

CHICA, C20orf129, dJ616B8.3

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human FAM83D

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: HFQSSNKFDHLTNRKPQSKELTLGNLLRMRLARLSSTPRKADLDPEMPAE

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

67kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_112181

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GAT-1 Antibody
R30811 100 µg

GAT-1 Antibody

Sign In for Pricing
View Details
KIAA2026 Human Gene Knockout Kit (CRISPR)
KN220620LP 1 Kit

KIAA2026 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
HYAL2 Polyclonal Antibody
E-AB-11315-01 20 µL

HYAL2 Polyclonal Antibody

Sign In for Pricing
View Details
HYAL2 Polyclonal Antibody
E-AB-11315-02 60 µL

HYAL2 Polyclonal Antibody

Sign In for Pricing
View Details
HYAL2 Polyclonal Antibody
E-AB-11315-03 120 µL

HYAL2 Polyclonal Antibody

Sign In for Pricing
View Details
HYAL2 Polyclonal Antibody
E-AB-11315-04 200 µL

HYAL2 Polyclonal Antibody

Sign In for Pricing
View Details