Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MVB12B Rabbit Polyclonal Antibody (FITC)

MVB12B Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

C9orf28, FAM125B

UniProt

Q9H7P6

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human MVB12B

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: HISLTLPATFRGRNSTRTDYEYQHSNLYAISAMDGVPFMISEKFSCVPES

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_258257

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CSF2 (Colony Stimulating Factor 2 (Granulocyte-Macrophage), GMCSF, MGC131935, MGC138897) (APC)
MBS6166622-01 0.1 mL

CSF2 (Colony Stimulating Factor 2 (Granulocyte-Macrophage), GMCSF, MGC131935, MGC138897) (APC)

Sign In for Pricing
View Details
CSF2 (Colony Stimulating Factor 2 (Granulocyte-Macrophage), GMCSF, MGC131935, MGC138897) (APC)
MBS6166622-02 5x 0.1 mL

CSF2 (Colony Stimulating Factor 2 (Granulocyte-Macrophage), GMCSF, MGC131935, MGC138897) (APC)

Sign In for Pricing
View Details
Recombinant Coturnix coturnix Fibroblast growth factor receptor 4 (FGFR4), partial
MBS1334140-01 0.5 mg (E-Coli)

Recombinant Coturnix coturnix Fibroblast growth factor receptor 4 (FGFR4), partial

Sign In for Pricing
View Details
Recombinant Coturnix coturnix Fibroblast growth factor receptor 4 (FGFR4), partial
MBS1334140-02 0.05 mg (Baculovirus)

Recombinant Coturnix coturnix Fibroblast growth factor receptor 4 (FGFR4), partial

Sign In for Pricing
View Details
Recombinant Coturnix coturnix Fibroblast growth factor receptor 4 (FGFR4), partial
MBS1334140-03 0.5 mg (Yeast)

Recombinant Coturnix coturnix Fibroblast growth factor receptor 4 (FGFR4), partial

Sign In for Pricing
View Details
Recombinant Coturnix coturnix Fibroblast growth factor receptor 4 (FGFR4), partial
MBS1334140-04 0.05 mg (Mammalian-Cell)

Recombinant Coturnix coturnix Fibroblast growth factor receptor 4 (FGFR4), partial

Sign In for Pricing
View Details