Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FAM166A Rabbit Polyclonal Antibody (Biotin)

FAM166A Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

HSD46

UniProt

Q6J272

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human FAM166A

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: FTPDTPHPPCPPGRKGDSRDLGHPVYGEEAWKSATPVCEAPRQHQLYHCQ

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_001001710

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Saccharomyces cerevisiae (strain YJM789)(Baker's yeast) SDH5 Polyclonal Antibody
MBS7168425 Inquire

Rabbit anti-Saccharomyces cerevisiae (strain YJM789)(Baker's yeast) SDH5 Polyclonal Antibody

Sign In for Pricing
View Details
Cyclophilin A (CYPA, Cyclosporin A-binding Protein, CYPH, HGNC:9253, MGC12404, MGC23397, MGC117158, Peptidyl-prolyl cis-trans Isomerase A, Peptidyl Prolyl Cis Trans Isomerase A, Peptidylprolyl Isomerase A (Cyclophilin-A), PPIA, PPIase A, Rotamase A, Rotam
MBS6129700-01 0.1 mL

Cyclophilin A (CYPA, Cyclosporin A-binding Protein, CYPH, HGNC:9253, MGC12404, MGC23397, MGC117158, Peptidyl-prolyl cis-trans Isomerase A, Peptidyl Prolyl Cis Trans Isomerase A, Peptidylprolyl Isomerase A (Cyclophilin-A), PPIA, PPIase A, Rotamase A, Rotam

Sign In for Pricing
View Details
Cyclophilin A (CYPA, Cyclosporin A-binding Protein, CYPH, HGNC:9253, MGC12404, MGC23397, MGC117158, Peptidyl-prolyl cis-trans Isomerase A, Peptidyl Prolyl Cis Trans Isomerase A, Peptidylprolyl Isomerase A (Cyclophilin-A), PPIA, PPIase A, Rotamase A, Rotam
MBS6129700-02 5x 0.1 mL

Cyclophilin A (CYPA, Cyclosporin A-binding Protein, CYPH, HGNC:9253, MGC12404, MGC23397, MGC117158, Peptidyl-prolyl cis-trans Isomerase A, Peptidyl Prolyl Cis Trans Isomerase A, Peptidylprolyl Isomerase A (Cyclophilin-A), PPIA, PPIase A, Rotamase A, Rotam

Sign In for Pricing
View Details
Calumenin shRNA Plasmid (m)
sc-60321-SH 20 µg

Calumenin shRNA Plasmid (m)

Sign In for Pricing
View Details
ZNF697 Rabbit Polyclonal Antibody
TA339860 100 µL

ZNF697 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Goat Mouse IgG Secondary Antibody HRP Conjugated
orb713455 1 mL

Goat Mouse IgG Secondary Antibody HRP Conjugated

Sign In for Pricing
View Details