Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FAM181B Rabbit Polyclonal Antibody (HRP)

FAM181B Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

A6NEQ2

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human FAM181B

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LSGAEGGDVREATRDLLSFIDSASSNIKLALDKPGKSKRKVNHRKYLQKQ

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Mouse, Porcine, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_787081

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hepatocyte Specific (OCH1E5), CF405S conjugate, 0.1mg/mL
BNC040671-500 1x 500 µL

Hepatocyte Specific (OCH1E5), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS703029 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
alpha 1 Antitrypsin (SERPINA1) (NM_001127701) Human Over-expression Lysate
LY426859 100 µg

alpha 1 Antitrypsin (SERPINA1) (NM_001127701) Human Over-expression Lysate

Sign In for Pricing
View Details
GTPBP8 Human qPCR Primer Pair (NM_014170)
HP226463 200 Reactions

GTPBP8 Human qPCR Primer Pair (NM_014170)

Sign In for Pricing
View Details
CDRT15L2 Human Gene Knockout Kit (CRISPR)
KN431123 1 Kit

CDRT15L2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Ferritin, Light Chain (FTL) (Microglia Marker) (FTL/2338R), CF647 conjugate, 0.1mg/mL
BNC472338-100 1x 100 µL

Ferritin, Light Chain (FTL) (Microglia Marker) (FTL/2338R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details