Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FAM192A Rabbit Polyclonal Antibody (Biotin)

FAM192A Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

CDA10, NIP30, PIP30, CDA018, FAM192A, C16orf94

UniProt

Q9GZU8

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human FAM192A

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: KPIETKNKFSQAKLLAGAVKHKSSESGNSVKRLKPDPEPDDKNQEPSSCK

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_079222

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-ErbB 4/ERBB4 Antibody Picoband® (Biotine Conjugate)
PA1881-Biotin 100 µg/Vial

Anti-ErbB 4/ERBB4 Antibody Picoband® (Biotine Conjugate)

Sign In for Pricing
View Details
Sccpdh ORF Vector (Mouse) (pORF)
ORF056725 1.0 µg DNA

Sccpdh ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Mucin 1 / EMA / Episialin / CD227 (VU-2G7), 0.2mg/mL
BNUB0630-100 1x 100 µL

Mucin 1 / EMA / Episialin / CD227 (VU-2G7), 0.2mg/mL

Sign In for Pricing
View Details
Human Collagen Alpha 2 (VIII) chain (COL8A2) ELISA Kit
MBS7249129-01 48 Well

Human Collagen Alpha 2 (VIII) chain (COL8A2) ELISA Kit

Sign In for Pricing
View Details
Human Collagen Alpha 2 (VIII) chain (COL8A2) ELISA Kit
MBS7249129-02 96 Well

Human Collagen Alpha 2 (VIII) chain (COL8A2) ELISA Kit

Sign In for Pricing
View Details
Human Collagen Alpha 2 (VIII) chain (COL8A2) ELISA Kit
MBS7249129-03 5x 96 Well

Human Collagen Alpha 2 (VIII) chain (COL8A2) ELISA Kit

Sign In for Pricing
View Details