Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FAM192A Rabbit Polyclonal Antibody (HRP)

FAM192A Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CDA10, NIP30, PIP30, CDA018, FAM192A, C16orf94

UniProt

Q9GZU8

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human FAM192A

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KPIETKNKFSQAKLLAGAVKHKSSESGNSVKRLKPDPEPDDKNQEPSSCK

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_079222

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PPP4C Rabbit Polyclonal Antibody (PerCP-Cy5.5)
orb2400696 100 µL

PPP4C Rabbit Polyclonal Antibody (PerCP-Cy5.5)

Sign In for Pricing
View Details
Bis-Tris Buffer 0.5M, pH 6.5
40220013-2 250 mL

Bis-Tris Buffer 0.5M, pH 6.5

Sign In for Pricing
View Details
Appbp2 3'UTR Lenti-reporter-Luc Vector
12209086 1.0 µg

Appbp2 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) VPS2.2 Polyclonal Antibody
MBS7188885 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) VPS2.2 Polyclonal Antibody

Sign In for Pricing
View Details
RASGRP2 (RAS Guanyl-releasing Protein 2, Calcium and DAG-regulated Guanine Nucleotide Exchange Factor I, CalDAG-GEFI, Cdc25-like Protein, CDC25L, hCDC25L, F25B3.3 Kinase-like Protein, MCG7) (MaxLight 490)
132343-ML490 100 µL

RASGRP2 (RAS Guanyl-releasing Protein 2, Calcium and DAG-regulated Guanine Nucleotide Exchange Factor I, CalDAG-GEFI, Cdc25-like Protein, CDC25L, hCDC25L, F25B3.3 Kinase-like Protein, MCG7) (MaxLight 490)

Sign In for Pricing
View Details
Sheep Cystinosin (CTNS) ELISA kit
GTR10372182 96 Well

Sheep Cystinosin (CTNS) ELISA kit

Sign In for Pricing
View Details