Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FAM192A Rabbit Polyclonal Antibody (HRP)

FAM192A Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CDA10, NIP30, PIP30, CDA018, FAM192A, C16orf94

UniProt

Q9GZU8

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human FAM192A

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KPIETKNKFSQAKLLAGAVKHKSSESGNSVKRLKPDPEPDDKNQEPSSCK

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_079222

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ptpa (NM_138748) Mouse Tagged Lenti ORF Clone
MR219967L3 10 µg

Ptpa (NM_138748) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
C1orf27 AAV Vector (Human) (CMV)
14199101 1 µg

C1orf27 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
FOXP3, phosphorylated (S418) (FOXP3, IPEX, Forkhead box protein P3, Scurfin) (MaxLight 550) discontinued
035756-ML550 100 µL

FOXP3, phosphorylated (S418) (FOXP3, IPEX, Forkhead box protein P3, Scurfin) (MaxLight 550) discontinued

Sign In for Pricing
View Details
Human Serine incorporator 5 (SERINC5) ELISA Kit
abx545394 96 Tests

Human Serine incorporator 5 (SERINC5) ELISA Kit

Sign In for Pricing
View Details
NOP2 (NM_001258309) Human Tagged ORF Clone
RG234956 10 µg

NOP2 (NM_001258309) Human Tagged ORF Clone

Sign In for Pricing
View Details
DULLARD Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV813990 1.0 µg DNA

DULLARD Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details