Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FAM193A Rabbit Polyclonal Antibody (HRP)

FAM193A Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

C4orf8, RES4-22

UniProt

P78312

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human FAM193A

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EHQQNSKLVLAESPQPKGKNKKNKKKKGDRVNNSIDGVSLLLPSLGYNGA

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

139kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_003695

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Adenosine 3',5'-cyclic monophosphothioate Sp-isomer sodium salt
NA08994-01 1 mg

Adenosine 3',5'-cyclic monophosphothioate Sp-isomer sodium salt

Sign In for Pricing
View Details
Adenosine 3',5'-cyclic monophosphothioate Sp-isomer sodium salt
NA08994-02 2 mg

Adenosine 3',5'-cyclic monophosphothioate Sp-isomer sodium salt

Sign In for Pricing
View Details
Adenosine 3',5'-cyclic monophosphothioate Sp-isomer sodium salt
NA08994-03 5 mg

Adenosine 3',5'-cyclic monophosphothioate Sp-isomer sodium salt

Sign In for Pricing
View Details
Human Ninjurin-1, NINJ1 ELISA Kit
MBS915725-01 24 Well (LIMIT 1)

Human Ninjurin-1, NINJ1 ELISA Kit

Sign In for Pricing
View Details
Human Ninjurin-1, NINJ1 ELISA Kit
MBS915725-02 48 Well

Human Ninjurin-1, NINJ1 ELISA Kit

Sign In for Pricing
View Details
Human Ninjurin-1, NINJ1 ELISA Kit
MBS915725-03 96 Well

Human Ninjurin-1, NINJ1 ELISA Kit

Sign In for Pricing
View Details