Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FAM198B Rabbit Polyclonal Antibody (HRP)

FAM198B Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ENED, AD021, AD036, C4orf18, FAM198B

UniProt

Q6UWH4

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human FAM198B

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LAPPESQGNGSTLQPNVVYITLRSKRSKPANIRGTVKPKRRKKHAVASAA

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

58kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001026870

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SnoN Rabbit Polyclonal Antibody (Cy7)
orb1042776 100 µL

SnoN Rabbit Polyclonal Antibody (Cy7)

Sign In for Pricing
View Details
Ddr2 Mouse qPCR Primer Pair (NM_022563)
MP203713 200 Reactions

Ddr2 Mouse qPCR Primer Pair (NM_022563)

Sign In for Pricing
View Details
Human CEP68 Protein Lysate
MBS139302-01 0.02 mg

Human CEP68 Protein Lysate

Sign In for Pricing
View Details
Human CEP68 Protein Lysate
MBS139302-02 5x 0.02 mg

Human CEP68 Protein Lysate

Sign In for Pricing
View Details
Mouse Monoclonal CD63 Antibody (MEM-259) [PE]
NB100-77913PE 0.1 mL

Mouse Monoclonal CD63 Antibody (MEM-259) [PE]

Sign In for Pricing
View Details
Olr48 3'UTR GFP Stable Cell Line
TU265243 1.0 mL

Olr48 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details