Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FBXL15 Rabbit Polyclonal Antibody (FITC)

FBXL15 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

JET, PSD, Fbl15, FBXO37

UniProt

Q9H469

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human FBXL15

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: PPMEPSGGEQEPGAVRFLDLPWEDVLLPHVLNRVPLRQLLRLQRVSRAFR

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

32kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_077302

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ammonium Transporter Rh type B (RHBG) Bovine ELISA Kit
B4463 96 Tests

Ammonium Transporter Rh type B (RHBG) Bovine ELISA Kit

Sign In for Pricing
View Details
TST Polyclonal Antibody, FITC Conjugated
A69889-100 100 µL

TST Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Ribophorin I (RPN1)
MBS2068087-01 0.1 mL

FITC-Linked Polyclonal Antibody to Ribophorin I (RPN1)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Ribophorin I (RPN1)
MBS2068087-02 0.2 mL

FITC-Linked Polyclonal Antibody to Ribophorin I (RPN1)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Ribophorin I (RPN1)
MBS2068087-03 0.5 mL

FITC-Linked Polyclonal Antibody to Ribophorin I (RPN1)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Ribophorin I (RPN1)
MBS2068087-04 1 mL

FITC-Linked Polyclonal Antibody to Ribophorin I (RPN1)

Sign In for Pricing
View Details