Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FBXO46 Rabbit Polyclonal Antibody (FITC)

FBXO46 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Fbx46, FBXO34L, 20D7-FC4

UniProt

Q6PJ61

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human FBXO46

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: VDVVVTGVVDECIFFGKDGTKNVKEETVCLTVSPEEPPPPGQLFFLQNRG

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

64kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_001073938

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tau, 3-repeat isoform RD3 (Tau Protein, Microtubule-associated Protein, MAP)
MBS603973-01 0.2 mL

Tau, 3-repeat isoform RD3 (Tau Protein, Microtubule-associated Protein, MAP)

Sign In for Pricing
View Details
Tau, 3-repeat isoform RD3 (Tau Protein, Microtubule-associated Protein, MAP)
MBS603973-02 5x 0.2 mL

Tau, 3-repeat isoform RD3 (Tau Protein, Microtubule-associated Protein, MAP)

Sign In for Pricing
View Details
NDUFB1 Protein Lysate
OCOA13060-20UG 20 µg

NDUFB1 Protein Lysate

Sign In for Pricing
View Details
1,1'-[Dithiobis (methylene) ]biscyclopropaneacetic Acid
158595 50 mg

1,1'-[Dithiobis (methylene) ]biscyclopropaneacetic Acid

Sign In for Pricing
View Details
Mouse Monoclonal STING/TMEM173 Antibody (STING1/7432)
NBP3-13942-20ug 20 µg

Mouse Monoclonal STING/TMEM173 Antibody (STING1/7432)

Sign In for Pricing
View Details
BRMS1L, NT (BRMS1L, Breast cancer metastasis-suppressor 1-like protein, BRMS1-homolog protein p40, BRMS1-like protein p40) (Azide free) (HRP) discontinued
032585-HRP 200 µL

BRMS1L, NT (BRMS1L, Breast cancer metastasis-suppressor 1-like protein, BRMS1-homolog protein p40, BRMS1-like protein p40) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details