Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPR89A Rabbit Polyclonal Antibody (HRP)

GPR89A Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

GPHR, GPR89, SH120, GPR89B, UNQ192

UniProt

B7ZAQ6

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human GPR89A

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LEYRTIITEVLGELQFNFYHRWFDVIFLVSALSSILFLYLAHKQAPEKQM

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

53kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_057418

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Monoclonal HSPA8/HSC71/Hsc70 Antibody (1B5) [HRP]
NBP1-97868H 0.2 mL

Rat Monoclonal HSPA8/HSC71/Hsc70 Antibody (1B5) [HRP]

Sign In for Pricing
View Details
Optical Bench
1110910/1 1 Each

Optical Bench

Sign In for Pricing
View Details
Human anti-alpha-Fodrin antibody IgG, anti-alpha-fodrin Ab IgG ELISA KIT
ED0421Hu-01 96 Well

Human anti-alpha-Fodrin antibody IgG, anti-alpha-fodrin Ab IgG ELISA KIT

Sign In for Pricing
View Details
Mouse Heart PrimaCell™5: Normal Saphenous Vein Endothelial Cells
2-82049 1 Kit

Mouse Heart PrimaCell™5: Normal Saphenous Vein Endothelial Cells

Sign In for Pricing
View Details
UGT1A1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K2583307 1.0 µg DNA

UGT1A1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
ALX4 antibody - C-terminal region (ARP36701_P050)
ARP36701_P050 100 µL

ALX4 antibody - C-terminal region (ARP36701_P050)

Sign In for Pricing
View Details