Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPR176 Rabbit Polyclonal Antibody (HRP)

GPR176 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HB-954

UniProt

Q14439

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human GPR176

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LEPSIRSGSQLLEMFHIGQQQIFKPTEDEEESEAKYIGSADFQAKEIFST

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

56kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

NP_009154

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CS1 Protein, hFc-His Tag
orb689363-01 10 µg

Human CS1 Protein, hFc-His Tag

Sign In for Pricing
View Details
Human CS1 Protein, hFc-His Tag
orb689363-02 50 µg

Human CS1 Protein, hFc-His Tag

Sign In for Pricing
View Details
Human CS1 Protein, hFc-His Tag
orb689363-03 100 µg

Human CS1 Protein, hFc-His Tag

Sign In for Pricing
View Details
Lentiviral human GPER1 sgRNA gene knockout kit - Lentiviral human GPER1 sgRNA gene knockout kit (100)
GTR15369385 1 Vial

Lentiviral human GPER1 sgRNA gene knockout kit - Lentiviral human GPER1 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
5-HT2 antagonist 1
T12597-01 1 mg

5-HT2 antagonist 1

Sign In for Pricing
View Details
5-HT2 antagonist 1
T12597-02 5 mg

5-HT2 antagonist 1

Sign In for Pricing
View Details