Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPR180 Rabbit Polyclonal Antibody (HRP)

GPR180 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ITR

UniProt

Q86V85

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human GPR180

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FQAQEWLKLQQSSHGYSCSEKLSKAQLTMTMNQTEHNLTVSQIPSPQTWH

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

48kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Porcine, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_851320

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vmn1r55 Mouse Gene Knockout Kit (CRISPR)
KN519069 1 Kit

Vmn1r55 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (EGP40/1373), CF405S conjugate, 0.1mg/mL
BNC041373-100 1x 100 µL

Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (EGP40/1373), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HER-2 / c-erbB-2 / neu / CD340 (ERBB2/3257), CF568 conjugate, 0.1mg/mL
BNC683257-500 1x 500 µL

HER-2 / c-erbB-2 / neu / CD340 (ERBB2/3257), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PE/Cyanine5.5 Mouse IgG2b, κ Isotype Control[MPC-11]
E-AB-F09812I-01 20 Tests

PE/Cyanine5.5 Mouse IgG2b, κ Isotype Control[MPC-11]

Sign In for Pricing
View Details
PE/Cyanine5.5 Mouse IgG2b, κ Isotype Control[MPC-11]
E-AB-F09812I-02 100 Tests

PE/Cyanine5.5 Mouse IgG2b, κ Isotype Control[MPC-11]

Sign In for Pricing
View Details
PE/Cyanine5.5 Mouse IgG2b, κ Isotype Control[MPC-11]
E-AB-F09812I-03 2x 100 Tests

PE/Cyanine5.5 Mouse IgG2b, κ Isotype Control[MPC-11]

Sign In for Pricing
View Details