Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FAM110D Rabbit Polyclonal Antibody (HRP)

FAM110D Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

GRRP1

UniProt

Q8TAY7

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human FAM110D

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PPSTPSRGRTPSAVERLEADKAKYVKTHQVIARRQEPALRGSPGPLTPHP

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_079145

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NM23A (NME1) Human Gene Knockout Kit (CRISPR)
KN401731 1 Kit

NM23A (NME1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human MFSD6 activation kit by CRISPRa
GA110303 1 Kit

Human MFSD6 activation kit by CRISPRa

Sign In for Pricing
View Details
Von Willebrand Factor / Factor VIII Related-Ag (Endothelial Marker) (rVWF/2480), CF640R conjugate, 0.1mg/mL
BNC403607-100 1x 100 µL

Von Willebrand Factor / Factor VIII Related-Ag (Endothelial Marker) (rVWF/2480), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Uncoated Human GCP-2 (Granulocyte Chemotactic Protein 2) ELISA Kit
E-UNEL-H0308-01 5x 96 Tests

Uncoated Human GCP-2 (Granulocyte Chemotactic Protein 2) ELISA Kit

Sign In for Pricing
View Details
Uncoated Human GCP-2 (Granulocyte Chemotactic Protein 2) ELISA Kit
E-UNEL-H0308-02 15x 96 Tests

Uncoated Human GCP-2 (Granulocyte Chemotactic Protein 2) ELISA Kit

Sign In for Pricing
View Details
Dowtherm A
TRC-D537100-50ML 50 mL

Dowtherm A

Sign In for Pricing
View Details