Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FAM110D Rabbit Polyclonal Antibody (HRP)

FAM110D Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

GRRP1

UniProt

Q8TAY7

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human FAM110D

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PPSTPSRGRTPSAVERLEADKAKYVKTHQVIARRQEPALRGSPGPLTPHP

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_079145

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLK2 (NM_006622) Human Over-expression Lysate
LY401982 100 µg

PLK2 (NM_006622) Human Over-expression Lysate

Sign In for Pricing
View Details
MLKL Rabbit Monoclonal Antibody
TA423307 100 µL

MLKL Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
DNAL1 Mouse Monoclonal Antibody [Clone ID: AT29E4]
AM50072PU-S 50 µL

DNAL1 Mouse Monoclonal Antibody [Clone ID: AT29E4]

Sign In for Pricing
View Details
ProteoSpin Total Protein Concentration, Detergent Clean-Up And Endotoxin Removal Maxi Kit
22200 4 Preparations

ProteoSpin Total Protein Concentration, Detergent Clean-Up And Endotoxin Removal Maxi Kit

Sign In for Pricing
View Details
UNC5B Human Gene Knockout Kit (CRISPR)
KN218267 1 Kit

UNC5B Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Phosphatidic acid phosphatase type 2B (PLPP3) Rabbit Polyclonal Antibody
AP05146PU-N 100 µg

Phosphatidic acid phosphatase type 2B (PLPP3) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details