Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HAUS2 Rabbit Polyclonal Antibody (Biotin)

HAUS2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

CEP27, C15orf25, HsT17025

UniProt

Q9NVX0

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human HAUS2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LAENILKWRKQQNEVSSCIPKILAEESYLYKHDIIMPPLPFTSKVHVQTI

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

25kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Porcine, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_060567

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal EMMPRIN/CD147 Antibody (BSG/9290R) [DyLight 350]
NBP3-24073UV 0.1 mL

Rabbit Monoclonal EMMPRIN/CD147 Antibody (BSG/9290R) [DyLight 350]

Sign In for Pricing
View Details
CD20/ MS4A1 (B-Cell Marker) (MS4A1/3411), CF647 conjugate, 0.1mg/mL
BNC473411-500 1x 500 µL

CD20/ MS4A1 (B-Cell Marker) (MS4A1/3411), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TRIP13, NT (Thyroid Receptor-interacting Protein 13, Thyroid Hormone Receptor Interactor 13, TR-interacting Protein 13, TRIP-13, Human Papillomavirus Type 16 E1 Protein-binding Protein, HPV16 E1 Protein-binding Protein, 16E1-BP) (FITC)
MBS6502582-01 0.2 mL

TRIP13, NT (Thyroid Receptor-interacting Protein 13, Thyroid Hormone Receptor Interactor 13, TR-interacting Protein 13, TRIP-13, Human Papillomavirus Type 16 E1 Protein-binding Protein, HPV16 E1 Protein-binding Protein, 16E1-BP) (FITC)

Sign In for Pricing
View Details
TRIP13, NT (Thyroid Receptor-interacting Protein 13, Thyroid Hormone Receptor Interactor 13, TR-interacting Protein 13, TRIP-13, Human Papillomavirus Type 16 E1 Protein-binding Protein, HPV16 E1 Protein-binding Protein, 16E1-BP) (FITC)
MBS6502582-02 5x 0.2 mL

TRIP13, NT (Thyroid Receptor-interacting Protein 13, Thyroid Hormone Receptor Interactor 13, TR-interacting Protein 13, TRIP-13, Human Papillomavirus Type 16 E1 Protein-binding Protein, HPV16 E1 Protein-binding Protein, 16E1-BP) (FITC)

Sign In for Pricing
View Details
Cyclin C Rabbit Polyclonal Antibody (PerCP)
orb2558975 100 µL

Cyclin C Rabbit Polyclonal Antibody (PerCP)

Sign In for Pricing
View Details
Bravo Freezer Boxes Divider - 12 x 12 Array for 9mm Diameter Tubes
FRE2224 1 Each

Bravo Freezer Boxes Divider - 12 x 12 Array for 9mm Diameter Tubes

Sign In for Pricing
View Details