Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HAUS2 Rabbit Polyclonal Antibody (Biotin)

HAUS2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

CEP27, C15orf25, HsT17025

UniProt

Q9NVX0

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human HAUS2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LAENILKWRKQQNEVSSCIPKILAEESYLYKHDIIMPPLPFTSKVHVQTI

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

25kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Porcine, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_060567

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DHX8 (DEAH (Asp-Glu-Ala-His) Box Polypeptide 8, DEAH Box Protein 8, DHX-8, DEAD/H (Asp-Glu-Ala-Asp/His) Box Polypeptide 8, DDX8, DDX-8, HRH1, Human RNA Helicase 1, PRP22, PRPF22) (MaxLight 550)
MBS6211145-01 0.1 mL

DHX8 (DEAH (Asp-Glu-Ala-His) Box Polypeptide 8, DEAH Box Protein 8, DHX-8, DEAD/H (Asp-Glu-Ala-Asp/His) Box Polypeptide 8, DDX8, DDX-8, HRH1, Human RNA Helicase 1, PRP22, PRPF22) (MaxLight 550)

Sign In for Pricing
View Details
DHX8 (DEAH (Asp-Glu-Ala-His) Box Polypeptide 8, DEAH Box Protein 8, DHX-8, DEAD/H (Asp-Glu-Ala-Asp/His) Box Polypeptide 8, DDX8, DDX-8, HRH1, Human RNA Helicase 1, PRP22, PRPF22) (MaxLight 550)
MBS6211145-02 5x 0.1 mL

DHX8 (DEAH (Asp-Glu-Ala-His) Box Polypeptide 8, DEAH Box Protein 8, DHX-8, DEAD/H (Asp-Glu-Ala-Asp/His) Box Polypeptide 8, DDX8, DDX-8, HRH1, Human RNA Helicase 1, PRP22, PRPF22) (MaxLight 550)

Sign In for Pricing
View Details
Recombinant Human BRI3BP Protein - (Dry Ice)
H00140707-P01-25ug 25 µg

Recombinant Human BRI3BP Protein - (Dry Ice)

Sign In for Pricing
View Details
Cat Interleukin 10, IL-10 ELISA KIT
E0030Cat-01 48 Well

Cat Interleukin 10, IL-10 ELISA KIT

Sign In for Pricing
View Details
Cat Interleukin 10, IL-10 ELISA KIT
E0030Cat-02 96 Well

Cat Interleukin 10, IL-10 ELISA KIT

Sign In for Pricing
View Details
Cat Interleukin 10, IL-10 ELISA KIT
E0030Cat-03 5x 96 Tests

Cat Interleukin 10, IL-10 ELISA KIT

Sign In for Pricing
View Details