Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HEATR8 Rabbit Polyclonal Antibody (FITC)

HEATR8 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

HEATR8, C1orf175

UniProt

Q68CQ1

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human HEATR8

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LDLDSKDVSRPDSQGRLCPASNPILSPSSTEAPRLSSGNHPQSNSEDAFK

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

68kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_001034553

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Inositol Polyphosphate-4-Phosphatase Type I 107kDa (INPP4A) Antibody Pair Kit (with Standard)
MBS2104289-01 5x 96 Tests

Human Inositol Polyphosphate-4-Phosphatase Type I 107kDa (INPP4A) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Human Inositol Polyphosphate-4-Phosphatase Type I 107kDa (INPP4A) Antibody Pair Kit (with Standard)
MBS2104289-02 5x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1,5x 96 Tests)

Human Inositol Polyphosphate-4-Phosphatase Type I 107kDa (INPP4A) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Human Inositol Polyphosphate-4-Phosphatase Type I 107kDa (INPP4A) Antibody Pair Kit (with Standard)
MBS2104289-03 10x 96 Tests

Human Inositol Polyphosphate-4-Phosphatase Type I 107kDa (INPP4A) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Human Inositol Polyphosphate-4-Phosphatase Type I 107kDa (INPP4A) Antibody Pair Kit (with Standard)
MBS2104289-04 10x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1, 10x 96 Tests)

Human Inositol Polyphosphate-4-Phosphatase Type I 107kDa (INPP4A) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Recombinant Yersinia pseudotuberculosis serotype O:1b Na (+) -translocating NADH-quinone reductase subunit D
orb2918349-01 20 µg

Recombinant Yersinia pseudotuberculosis serotype O:1b Na (+) -translocating NADH-quinone reductase subunit D

Sign In for Pricing
View Details
Recombinant Yersinia pseudotuberculosis serotype O:1b Na (+) -translocating NADH-quinone reductase subunit D
orb2918349-02 100 µg

Recombinant Yersinia pseudotuberculosis serotype O:1b Na (+) -translocating NADH-quinone reductase subunit D

Sign In for Pricing
View Details