Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HENMT1 Rabbit Polyclonal Antibody (HRP)

HENMT1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HEN1, C1orf59

UniProt

Q5T8I9

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human HENMT1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RETAIQFKPPLYRQRYQFVKNLVDQHEPKKVADLGCGDTSLLRLLKVNPC

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

43kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_653185

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Clinafloxacin Hydrochloride
TRC-C579000-1G 1 g

Clinafloxacin Hydrochloride

Sign In for Pricing
View Details
AUTS2 (NM_001127232) Human Over-expression Lysate
LC426731 20 µg

AUTS2 (NM_001127232) Human Over-expression Lysate

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon: sigmoid
CS622949 5x 5 µm

Frozen Tissue Sections, Colon: sigmoid

Sign In for Pricing
View Details
OSGIN2 Human Gene Knockout Kit (CRISPR)
KN423771 1 Kit

OSGIN2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
IRS4 (NM_003604) Human Over-expression Lysate
LC401194 20 µg

IRS4 (NM_003604) Human Over-expression Lysate

Sign In for Pricing
View Details
KLF12 Mouse Monoclonal Antibody [Clone ID: OTI2A5]
CF810316 100 µg

KLF12 Mouse Monoclonal Antibody [Clone ID: OTI2A5]

Sign In for Pricing
View Details