Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HIST1H2AE Rabbit Polyclonal Antibody (FITC)

HIST1H2AE Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

H2A.1, H2A.2, H2A/a, H2AC4, H2AFA, HIST1H2AE

UniProt

P04908

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human HIST1H2AE

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: GKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAA

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

14kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_066390

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Elongation of very long chain fatty acids protein 2 (ELOVL2) ELISA Kit
YP-W200108-01 48 Tests

Bovine Elongation of very long chain fatty acids protein 2 (ELOVL2) ELISA Kit

Sign In for Pricing
View Details
Bovine Elongation of very long chain fatty acids protein 2 (ELOVL2) ELISA Kit
YP-W200108-02 96 Tests

Bovine Elongation of very long chain fatty acids protein 2 (ELOVL2) ELISA Kit

Sign In for Pricing
View Details
Recombinant Human Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial (DLAT), partial
orb3004018-01 20 µg

Recombinant Human Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial (DLAT), partial

Sign In for Pricing
View Details
Recombinant Human Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial (DLAT), partial
orb3004018-02 100 µg

Recombinant Human Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial (DLAT), partial

Sign In for Pricing
View Details
Recombinant Human Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial (DLAT), partial
orb3004018-03 1 mg

Recombinant Human Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial (DLAT), partial

Sign In for Pricing
View Details
PLG Protein Vector (Human) (pPB-C-His)
PV111870 500 ng

PLG Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details