Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HIST1H2AE Rabbit Polyclonal Antibody (HRP)

HIST1H2AE Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

H2A.1, H2A.2, H2A/a, H2AC4, H2AFA, HIST1H2AE

UniProt

P04908

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human HIST1H2AE

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAA

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

14kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_066390

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

YGR107W Antibody
orb850562 2 mg

YGR107W Antibody

Sign In for Pricing
View Details
Afasevikumab ELISA Kit
KET-10765 96 Tests

Afasevikumab ELISA Kit

Sign In for Pricing
View Details
IgE, Heavy Chain (AP)
MBS6248012-01 0.1 mL

IgE, Heavy Chain (AP)

Sign In for Pricing
View Details
IgE, Heavy Chain (AP)
MBS6248012-02 5x 0.1 mL

IgE, Heavy Chain (AP)

Sign In for Pricing
View Details
Plant Pulmonary Surfactant Associated Protein D (SPD) ELISA Kit
MBS9378271 Inquire

Plant Pulmonary Surfactant Associated Protein D (SPD) ELISA Kit

Sign In for Pricing
View Details
GLT1D1 Rabbit Polyclonal Antibody (BF750)
orb2525056 100 µL

GLT1D1 Rabbit Polyclonal Antibody (BF750)

Sign In for Pricing
View Details