Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HMCN2 Rabbit Polyclonal Antibody (Biotin)

HMCN2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

Q8NDA2

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human HMCN2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: XPPSIREDGRKANVSGMAGQSLTLECDANGFPVPEIVWLKDAQLIPKVGG

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

65kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Porcine

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-VMAT1 Antibody FL594 Conjugate
75-430-FL594 200 µL

Anti-VMAT1 Antibody FL594 Conjugate

Sign In for Pricing
View Details
Frataxin (FXN) Mouse Monoclonal Antibody [Clone ID: OTI3B6]
TA504334 100 µL

Frataxin (FXN) Mouse Monoclonal Antibody [Clone ID: OTI3B6]

Sign In for Pricing
View Details
LYRIC Polyclonal Antibody, RBITC Conjugated
bs-2231R-RBITC 100 µL

LYRIC Polyclonal Antibody, RBITC Conjugated

Sign In for Pricing
View Details
ARL4D Polyclonal Antibody, FITC Conjugated
A57151-100 100 µL

ARL4D Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
Anti-Hsp20/HSPB6 Antibody Picoband® Fluoro550 Conjugated
A07981-1-Fluoro550 100 µg/Vial

Anti-Hsp20/HSPB6 Antibody Picoband® Fluoro550 Conjugated

Sign In for Pricing
View Details
Maleimide Coated - 96 well plates - 8 Well Breakable Strips on single well holding frame - Black PS
MGB22F2-MAL 10x 96 Well Plates

Maleimide Coated - 96 well plates - 8 Well Breakable Strips on single well holding frame - Black PS

Sign In for Pricing
View Details