Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HMCN2 Rabbit Polyclonal Antibody (HRP)

HMCN2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q8NDA2

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human HMCN2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: XPPSIREDGRKANVSGMAGQSLTLECDANGFPVPEIVWLKDAQLIPKVGG

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

65kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Porcine

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal CD97 Antibody [DyLight 755]
NBP2-99764IR 0.1 mL

Rabbit Polyclonal CD97 Antibody [DyLight 755]

Sign In for Pricing
View Details
Rabbit Polyclonal CBFA2T3 Antibody
NBP2-57636 100 µL

Rabbit Polyclonal CBFA2T3 Antibody

Sign In for Pricing
View Details
Mouse Anti-Human IgM
orb1786853-01 100 µL

Mouse Anti-Human IgM

Sign In for Pricing
View Details
Mouse Anti-Human IgM
orb1786853-02 500 µL

Mouse Anti-Human IgM

Sign In for Pricing
View Details
Mouse Monoclonal Casein Kinase 2 alpha Antibody (3D9)
H00001457-M01 0.1 mg

Mouse Monoclonal Casein Kinase 2 alpha Antibody (3D9)

Sign In for Pricing
View Details
Recombinant Rickettsia felis Protein translocase subunit SecF (secF), partial
MBS7081534 Inquire

Recombinant Rickettsia felis Protein translocase subunit SecF (secF), partial

Sign In for Pricing
View Details