Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HMCN2 Rabbit Polyclonal Antibody (HRP)

HMCN2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q8NDA2

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human HMCN2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: XPPSIREDGRKANVSGMAGQSLTLECDANGFPVPEIVWLKDAQLIPKVGG

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

65kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Porcine

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human SSX7 Pre-designed siRNA Set B
SI015848B 1 Each

Human SSX7 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Rat Monoclonal CD1d Antibody (1B1) [CoraFluor 1]
NBP1-43461CL1 0.1 mL

Rat Monoclonal CD1d Antibody (1B1) [CoraFluor 1]

Sign In for Pricing
View Details
RIZ1 (PRDM2) (NM_012231) Human Tagged ORF Clone
RC214550 10 µg

RIZ1 (PRDM2) (NM_012231) Human Tagged ORF Clone

Sign In for Pricing
View Details
TRIM22 (NM_006074) Human Over-expression Lysate
LC401829 20 µg

TRIM22 (NM_006074) Human Over-expression Lysate

Sign In for Pricing
View Details
TmpA, Recombinant, T. Pallidum discontinued. see T8300-52
397304 100 µg

TmpA, Recombinant, T. Pallidum discontinued. see T8300-52

Sign In for Pricing
View Details
Rabbit Monoclonal CDNF Antibody (104) [Alexa Fluor 700]
NBP2-90322AF700 0.1 mL

Rabbit Monoclonal CDNF Antibody (104) [Alexa Fluor 700]

Sign In for Pricing
View Details