Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IKBIP Rabbit Polyclonal Antibody (FITC)

IKBIP Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

IKIP

UniProt

Q70UQ0

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human IKBIP

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MSEVKSRKKSGPKGAPAAEPGKRSEGGKTPVARSSGGGGWADPRTCLSLL

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ENO2 Antibody
orb1257946 100 µL

ENO2 Antibody

Sign In for Pricing
View Details
Rat Monoclonal mouse Semaphorin 6C extracellular domain Antibody
orb1152725 100 µg

Rat Monoclonal mouse Semaphorin 6C extracellular domain Antibody

Sign In for Pricing
View Details
GABARAPL1, NT (Gamma-aminobutyric Acid Receptor-associated Protein-like 1, Early Estrogen-regulated Protein, GABA (A) Receptor-associated Protein-like 1, Glandular Epithelial Cell Protein 1, GEC-1, GEC1) (MaxLight 550) discontinued
029481-ML550 100 µL

GABARAPL1, NT (Gamma-aminobutyric Acid Receptor-associated Protein-like 1, Early Estrogen-regulated Protein, GABA (A) Receptor-associated Protein-like 1, Glandular Epithelial Cell Protein 1, GEC-1, GEC1) (MaxLight 550) discontinued

Sign In for Pricing
View Details
SBK2 Protein Vector (Human) (pPM-C-HA)
PV127888 500 ng

SBK2 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
ZNF423 3'UTR GFP Stable Cell Line
TU079164 1.0 mL

ZNF423 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Lentiviral human PPIH shRNA (UAS) - Lentiviral human PPIH shRNA (UAS) plasmid
GTR15107071 1 Vial

Lentiviral human PPIH shRNA (UAS) - Lentiviral human PPIH shRNA (UAS) plasmid

Sign In for Pricing
View Details